Lineage for d1rnra_ (1rnr A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2448Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 2449Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 2557Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins)
  6. 2613Protein Ribonucleotide reductase R2 [47257] (3 species)
  7. 2614Species Escherichia coli [TaxId:562] [47258] (8 PDB entries)
  8. 2629Domain d1rnra_: 1rnr A: [16798]

Details for d1rnra_

PDB Entry: 1rnr (more details), 2.5 Å

PDB Description: autocatalytic generation of dopa in the engineered protein r2 f208y from escherichia coli ribonucleotide reductase and crystal structure of the dopa-208 protein

SCOP Domain Sequences for d1rnra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rnra_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia coli}
ayttfsatkndqlkepmffgqpvqvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfntrsnpipwintwlv

SCOP Domain Coordinates for d1rnra_:

Click to download the PDB-style file with coordinates for d1rnra_.
(The format of our PDB-style files is described here.)

Timeline for d1rnra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rnrb_