Lineage for d2r4wb_ (2r4w B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686141Protein Hemoglobin I [46464] (2 species)
  7. 2686142Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (38 PDB entries)
  8. 2686216Domain d2r4wb_: 2r4w B: [167978]
    automated match to d1nxfa_
    complexed with cmo, hem

Details for d2r4wb_

PDB Entry: 2r4w (more details), 1.8 Å

PDB Description: ligand migration and binding in the dimeric hemoglobin of scapharca inaequivalvis: m37f with co bound
PDB Compounds: (B:) Globin-1

SCOPe Domain Sequences for d2r4wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r4wb_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalfttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d2r4wb_:

Click to download the PDB-style file with coordinates for d2r4wb_.
(The format of our PDB-style files is described here.)

Timeline for d2r4wb_: