Lineage for d2r4pa_ (2r4p A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3022096Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 3022343Family f.4.3.4: Outer membrane protein transport protein [111361] (2 proteins)
    Pfam PF03349; monomeric (14,16) barrel; plugged by an N-terminal all-alpha subdomain (1-40)
  6. 3022350Protein automated matches [190968] (2 species)
    not a true protein
  7. 3022360Species Escherichia coli [TaxId:562] [188604] (3 PDB entries)
  8. 3022363Domain d2r4pa_: 2r4p A: [167973]
    automated match to d1t16a_
    complexed with lda; mutant

Details for d2r4pa_

PDB Entry: 2r4p (more details), 2.9 Å

PDB Description: crystal structure of the long-chain fatty acid transporter fadl mutant g212e
PDB Compounds: (A:) Long-chain fatty acid transport protein

SCOPe Domain Sequences for d2r4pa_:

Sequence, based on SEQRES records: (download)

>d2r4pa_ f.4.3.4 (A:) automated matches {Escherichia coli [TaxId: 562]}
agfqlnefsssglgraysgegaiaddagnvsrnpalitmfdrptfsagavyidpdvnisg
tspsgrslkadniaptawvpnmhfvapindqfgwgasitsnyglatefndtyaggsvggt
tdletmnlnlsgayrlnnawsfglgfnavyarakierfagdlgqlvagqimqspagqtqq
gqalaatangidsntktahlngnqwgfgwnaeilyeldknnryaltyrsevkidfkgnys
sdlnrafnnyglpiptatggatqsgyltlnlpemwevsgynrvdpqwaihyslaytswsq
fqqlkatstsgdtlfqkhegfkdayrialgttyyyddnwtfrtgiafddspvpaqnrsis
ipdqdrfwlsagttyafnkdasvdvgvsymhgqsvkinegpyqfesegkawlfgtnfnya
f

Sequence, based on observed residues (ATOM records): (download)

>d2r4pa_ f.4.3.4 (A:) automated matches {Escherichia coli [TaxId: 562]}
agfqlnefsssglgraysgegaiaddagnvsrnpalitmfdrptfsagavyidpdvnisg
tspsgrslkadniaptawvpnmhfvapindqfgwgasitsnyglatefndtyaggsvggt
tdletmnlnlsgayrlnnawsfglgfnavyarakierfagdlgqlvagqimqspagqtqq
gqalaatangidsntktahlngnqwgfgwnaeilyeldknnryaltyrsevkidfkgnys
sdlnrafnlpiptatggatqsgyltlnlpemwevsgynrvdpqwaihyslaytswsqfqq
lkatstsgdtlfqkhegfkdayrialgttyyyddnwtfrtgiafddspvpaqnrsisipd
qdrfwlsagttyafnkdasvdvgvsymhgqsvkinegpyqfesegkawlfgtnfnyaf

SCOPe Domain Coordinates for d2r4pa_:

Click to download the PDB-style file with coordinates for d2r4pa_.
(The format of our PDB-style files is described here.)

Timeline for d2r4pa_: