Lineage for d1av8b_ (1av8 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2316569Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2316722Protein Ribonucleotide reductase R2 [47257] (10 species)
  7. 2316756Species Escherichia coli [TaxId:562] [47258] (24 PDB entries)
  8. 2316798Domain d1av8b_: 1av8 B: [16797]
    complexed with feo

Details for d1av8b_

PDB Entry: 1av8 (more details), 2.8 Å

PDB Description: ribonucleotide reductase r2 subunit from e. coli
PDB Compounds: (B:) ribonucleotide reductase r2

SCOPe Domain Sequences for d1av8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1av8b_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlv

SCOPe Domain Coordinates for d1av8b_:

Click to download the PDB-style file with coordinates for d1av8b_.
(The format of our PDB-style files is described here.)

Timeline for d1av8b_: