SCOPe 2.01: Domain d1av8b_: 1av8 B:

Lineage for d1av8b_ (1av8 B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (9 species)

7. Species Escherichia coli [TaxId:562] [47258] (23 PDB entries)

8. Domain d1av8b_: 1av8 B: [16797]
   complexed with feo

Details for d1av8b_

PDB Entry: 1av8, 2.8 Å

PDB Description: ribonucleotide reductase r2 subunit from e. coli

PDB Compounds: (B:) ribonucleotide reductase r2

SCOPe Domain Sequences for d1av8b_:

Sequence; same for both SEQRES and ATOM records:

>d1av8b_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlv

Timeline for d1av8b_:

• d1av8b_ first appeared (with stable ids) in SCOP 1.55
  
• d1av8b_ appears in SCOP 1.75
  
• d1av8b_ appears in SCOPe 2.02
  
• d1av8b_ appears in the current release, SCOPe 2.08