Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) form dimers with different dimerisation modes |
Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
Protein automated matches [190403] (3 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188560] (1 PDB entry) |
Domain d2r3za1: 2r3z A:2-68 [167966] Other proteins in same PDB: d2r3za2, d2r3zb2 automated match to d1o80a_ |
PDB Entry: 2r3z (more details), 2.5 Å
SCOPe Domain Sequences for d2r3za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r3za1 d.9.1.1 (A:2-68) automated matches {Mouse (Mus musculus) [TaxId: 10090]} plartvrcncihiddgpvrmraigkleiipaslscprveiiatmkkndeqrclnpeskti knlmkaf
Timeline for d2r3za1:
View in 3D Domains from other chains: (mouse over for more information) d2r3zb1, d2r3zb2, d2r3zc_, d2r3zd_ |