Lineage for d2r3za1 (2r3z A:2-68)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175338Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2175339Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2175340Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2175656Protein automated matches [190403] (3 species)
    not a true protein
  7. 2175723Species Mouse (Mus musculus) [TaxId:10090] [188560] (1 PDB entry)
  8. 2175724Domain d2r3za1: 2r3z A:2-68 [167966]
    Other proteins in same PDB: d2r3za2, d2r3zb2
    automated match to d1o80a_

Details for d2r3za1

PDB Entry: 2r3z (more details), 2.5 Å

PDB Description: Crystal structure of mouse IP-10
PDB Compounds: (A:) Small-inducible cytokine B10

SCOPe Domain Sequences for d2r3za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r3za1 d.9.1.1 (A:2-68) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
plartvrcncihiddgpvrmraigkleiipaslscprveiiatmkkndeqrclnpeskti
knlmkaf

SCOPe Domain Coordinates for d2r3za1:

Click to download the PDB-style file with coordinates for d2r3za1.
(The format of our PDB-style files is described here.)

Timeline for d2r3za1: