Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
Protein Ribonucleotide reductase R2 [47257] (10 species) |
Species Escherichia coli [TaxId:562] [47258] (24 PDB entries) |
Domain d1mrrb_: 1mrr B: [16795] complexed with hg, mn |
PDB Entry: 1mrr (more details), 2.5 Å
SCOPe Domain Sequences for d1mrrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mrrb_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]} ayttfsatkndqlkepmffgqpvqvarydqqkydifekliekqlsffwrpeevdvsrdri dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln kdilcqyveyitnirmqavgldlpfntrsnpipwintwlv
Timeline for d1mrrb_: