SCOPe 2.01: Domain d2r2ga_: 2r2g A:

Lineage for d2r2ga_ (2r2g A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (51 species)
   not a true protein

7. Species Ocimum basilicum [TaxId:39350] [188465] (7 PDB entries)

8. Domain d2r2ga_: 2r2g A: [167936]
   automated match to d1qyca_
   complexed with emf, nap

Details for d2r2ga_

PDB Entry: 2r2g, 1.8 Å

PDB Description: structure of eugenol synthase from ocimum basilicum complexed with emdf

PDB Compounds: (A:) Eugenol synthase 1

SCOPe Domain Sequences for d2r2ga_:

Sequence; same for both SEQRES and ATOM records:

>d2r2ga_ c.2.1.0 (A:) automated matches {Ocimum basilicum [TaxId: 39350]}
gmkskilifggtgyignhmvkgslklghptyvftrpnsskttlldefqslgaiivkgeld
eheklvelmkkvdvvisalafpqildqfkileaikvagnikrflpsdfgveedrinalpp
fealierqrmirraieeanipytyvsancfasyfinyllrpydpkdeitvygtgeakfam
nyeqdiglytikvatdpralnrvviyrpstniitqlelisrwekkigkkfkkihvpeeei
valtkelpepenipiailhclfidgatmsydfkendveastlypelkfttidelldifvh
dppppasaaf

Timeline for d2r2ga_:

• d2r2ga_ is new in SCOPe 2.01-stable
  
• d2r2ga_ appears in SCOPe 2.02
  
• d2r2ga_ appears in the current release, SCOPe 2.08