SCOPe 2.01: Domain d2r26c_: 2r26 C:

Lineage for d2r26c_ (2r26 C:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.103: Citrate synthase [48255] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.103.1: Citrate synthase [48256] (2 families)

5. Family a.103.1.1: Citrate synthase [48257] (2 proteins)
   duplication: large domain consists of two structural repeats
   the second repeat is interrupted by the small domain

6. Protein automated matches [190675] (4 species)
   not a true protein

7. Species Thermoplasma acidophilum [TaxId:2303] [188213] (3 PDB entries)

8. Domain d2r26c_: 2r26 C: [167932]
   automated match to d1o7xc_
   complexed with cmc, oaa

Details for d2r26c_

PDB Entry: 2r26, 2.5 Å

PDB Description: The Structure of the Ternary Complex of Carboxymethyl Coenzyme A and Oxalateacetate with Citrate Synthase from the Thermophilic Archaeonthermoplasma Acidophilum

PDB Compounds: (C:) citrate synthase

SCOPe Domain Sequences for d2r26c_:

Sequence; same for both SEQRES and ATOM records:

>d2r26c_ a.103.1.1 (C:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
eiskgledvnikwtrlttidgnkgilryggysvediiasgaqdeeiqylflygnlpteqe
lrkyketvqkgykipdfvinairqlpresdavamqmaavaamaasetkfkwnkdtdrdva
aemigrmsaitvnvyrhimnmpaelpkpsdsyaesflnaafgrkatkeeidamntalily
tdhevpasttaglvavstlsdmysgitaalaalkgplhggaaeaaiaqfdeikdpamvek
wfndniingkkrlmgfghrvyktydprakifkgiaeklsskkpevhkvyeiatkledfgi
kafgskgiypntdyfsgivymsigfplrnniytalfalsrvtgwqahfieyveeqqrlir
pravyvgpaerkyvpiaer

Timeline for d2r26c_:

• d2r26c_ is new in SCOPe 2.01-stable
  
• d2r26c_ appears in SCOPe 2.02
  
• d2r26c_ appears in the current release, SCOPe 2.08