Lineage for d2r26a_ (2r26 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722943Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2722944Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2722945Family a.103.1.1: Citrate synthase [48257] (2 proteins)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2723011Protein automated matches [190675] (10 species)
    not a true protein
  7. 2723041Species Thermoplasma acidophilum [TaxId:2303] [188213] (3 PDB entries)
  8. 2723050Domain d2r26a_: 2r26 A: [167930]
    automated match to d1o7xc_
    complexed with cmc, oaa

Details for d2r26a_

PDB Entry: 2r26 (more details), 2.5 Å

PDB Description: The Structure of the Ternary Complex of Carboxymethyl Coenzyme A and Oxalateacetate with Citrate Synthase from the Thermophilic Archaeonthermoplasma Acidophilum
PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d2r26a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r26a_ a.103.1.1 (A:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
teeiskgledvnikwtrlttidgnkgilryggysvediiasgaqdeeiqylflygnlpte
qelrkyketvqkgykipdfvinairqlpresdavamqmaavaamaasetkfkwnkdtdrd
vaaemigrmsaitvnvyrhimnmpaelpkpsdsyaesflnaafgrkatkeeidamntali
lytdhevpasttaglvavstlsdmysgitaalaalkgplhggaaeaaiaqfdeikdpamv
ekwfndniingkkrlmgfghrvyktydprakifkgiaeklsskkpevhkvyeiatkledf
gikafgskgiypntdyfsgivymsigfplrnniytalfalsrvtgwqahfieyveeqqrl
irpravyvgpaerkyvpiaer

SCOPe Domain Coordinates for d2r26a_:

Click to download the PDB-style file with coordinates for d2r26a_.
(The format of our PDB-style files is described here.)

Timeline for d2r26a_: