SCOPe 2.08: Domain d2av8b_: 2av8 B:

Lineage for d2av8b_ (2av8 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (10 species)

7. Species Escherichia coli [TaxId:562] [47258] (24 PDB entries)

8. Domain d2av8b_: 2av8 B: [16793]
   complexed with fe2, feo; mutant

Details for d2av8b_

PDB Entry: 2av8, 2.46 Å

PDB Description: y122f mutant of ribonucleotide reductase from escherichia coli

PDB Compounds: (B:) ribonucleotide reductase r2

SCOPe Domain Sequences for d2av8b_:

Sequence; same for both SEQRES and ATOM records:

>d2av8b_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sfthiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlv

Timeline for d2av8b_:

• d2av8b_ first appeared (with stable ids) in SCOP 1.55
  
• d2av8b_ appears in SCOPe 2.07