Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins) Common fold covers whole protein structure |
Protein automated matches [190169] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188399] (46 PDB entries) |
Domain d2r24a_: 2r24 A: [167929] automated match to d1el3a_ complexed with ldt, nap |
PDB Entry: 2r24 (more details), 1.75 Å
SCOPe Domain Sequences for d2r24a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r24a_ c.1.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} masrlllnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiq eklreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgk effpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykp avnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaak hnkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvca llsctshkdypfheef
Timeline for d2r24a_: