Lineage for d2r1pa_ (2r1p A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2419618Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2419732Family c.1.9.3: Phosphotriesterase-like [51564] (3 protein domains)
    automatically mapped to Pfam PF02126
  6. 2419733Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (4 species)
  7. 2419734Species Agrobacterium tumefaciens [TaxId:358] [141815] (16 PDB entries)
    Uniprot Q93LD7 32-360
  8. 2419740Domain d2r1pa_: 2r1p A: [167923]
    automated match to d2d2ga1
    complexed with co, dpj, edo, fe2

Details for d2r1pa_

PDB Entry: 2r1p (more details), 1.8 Å

PDB Description: OpdA from Agrobacterium radiobacter with bound product diethyl thiophosphate from co-crystallisation with tetraethyl dithiopyrophosphate- 1.8 A
PDB Compounds: (A:) phosphotriesterase

SCOPe Domain Sequences for d2r1pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r1pa_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Agrobacterium tumefaciens [TaxId: 358]}
gdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalaekavrglrharaa
gvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsveeltqfflre
iqhgiedtgiragiikvattgkatpfqelvlraaaraslatgvpvtthtsasqrdgeqqa
aifeseglspsrvcighsddtddlsyltglaargylvgldrmpysaiglegnasalalfg
trswqtrallikalidrgykdrilvshdwlfgfssyvtnimdvmdrinpdgmafvplrvi
pflrekgvppetlagvtvanparflspt

SCOPe Domain Coordinates for d2r1pa_:

Click to download the PDB-style file with coordinates for d2r1pa_.
(The format of our PDB-style files is described here.)

Timeline for d2r1pa_: