Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins) automatically mapped to Pfam PF02126 |
Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (4 species) |
Species Agrobacterium tumefaciens [TaxId:358] [141815] (16 PDB entries) Uniprot Q93LD7 32-360 |
Domain d2r1na_: 2r1n A: [167922] automated match to d2d2ga1 complexed with co, epl, fe2 |
PDB Entry: 2r1n (more details), 1.7 Å
SCOPe Domain Sequences for d2r1na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r1na_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Agrobacterium tumefaciens [TaxId: 358]} gdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalaekavrglrharaa gvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsveeltqfflre iqhgiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtsasqrdgeqqa aifeseglspsrvcighsddtddlsyltglaargylvgldrmpysaiglegdasalalfg trswqtrallikalidrgykdrilvshdwlfgfssyvtnimdvmdrinpdgmafvplrvi pflrekgvppetlagvtvanparflspt
Timeline for d2r1na_: