SCOPe 2.07: Domain d2r1ma_: 2r1m A:

Lineage for d2r1ma_ (2r1m A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
   automatically mapped to Pfam PF02126

6. Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (5 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [141815] (16 PDB entries)
   Uniprot Q93LD7 32-360

8. Domain d2r1ma_: 2r1m A: [167921]
   automated match to d2d2ga1
   complexed with co, dpf, edo, fe2

Details for d2r1ma_

PDB Entry: 2r1m, 2.5 Å

PDB Description: opda from agrobacterium radiobacter with bound product diethyl phosphate from crystal soaking with diethyl 4-methoxyphenyl phosphate (450h)- 2.5 a

PDB Compounds: (A:) phosphotriesterase

SCOPe Domain Sequences for d2r1ma_:

Sequence; same for both SEQRES and ATOM records:

>d2r1ma_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Agrobacterium tumefaciens [TaxId: 358]}
gdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalaekavrglrharaa
gvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsveeltqfflre
iqhgiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtsasqrdgeqqa
aifeseglspsrvcighsddtddlsyltglaargylvgldrmpysaiglegdasalalfg
trswqtrallikalidrgykdrilvshdwlfgfssyvtnimdvmdrinpdgmafvplrvi
pflrekgvppetlagvtvanparflspt

Timeline for d2r1ma_:

• d2r1ma_ first appeared in SCOPe 2.01
  
• d2r1ma_ appears in SCOPe 2.06
  
• d2r1ma_ appears in the current release, SCOPe 2.08