Lineage for d2r1hc_ (2r1h C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688783Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [188309] (2 PDB entries)
  8. 2688790Domain d2r1hc_: 2r1h C: [167917]
    automated match to d1outa_
    complexed with edo, hem

Details for d2r1hc_

PDB Entry: 2r1h (more details), 1.9 Å

PDB Description: met-Trout IV hemoglobin at pH 6.3
PDB Compounds: (C:) Hemoglobin subunit alpha-4

SCOPe Domain Sequences for d2r1hc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r1hc_ a.1.1.2 (C:) automated matches {Rainbow trout (Oncorhynchus mykiss) [TaxId: 8022]}
slsakdkanvkaiwgkilpksdeigeqalsrmlvvypqtkayfshwasvapgsapvkkhg
itimnqiddcvghmddlfgfltklselhatklrvdptnfkilahnlivviaayfpaeftp
eihlsvdkflqqlalalaekyr

SCOPe Domain Coordinates for d2r1hc_:

Click to download the PDB-style file with coordinates for d2r1hc_.
(The format of our PDB-style files is described here.)

Timeline for d2r1hc_: