Lineage for d2r14a_ (2r14 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080289Protein Morphinone reductase [75053] (1 species)
  7. 2080290Species Pseudomonas putida [TaxId:303] [75054] (3 PDB entries)
  8. 2080291Domain d2r14a_: 2r14 A: [167912]
    automated match to d1gwja_
    complexed with fmn, txd

Details for d2r14a_

PDB Entry: 2r14 (more details), 1.4 Å

PDB Description: Structure of morphinone reductase in complex with tetrahydroNAD
PDB Compounds: (A:) morphinone reductase

SCOPe Domain Sequences for d2r14a_:

Sequence, based on SEQRES records: (download)

>d2r14a_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]}
npglftplqlgslslpnrvimapltrsrtpdsvpgrlqqiyygqrasagliiseatnisp
targyvytpgiwtdaqeagwkgvveavhakggrialqlwhvgrvshelvqpdgqqpvaps
alkaegaecfvefedgtaglhptstpraletdeipgivedyrqaaqrakragfdmvevha
anaclpnqflatgtnrrtdqyggsienrarfplevvdavaevfgpervgirltpflelfg
ltddepeamafylageldrrglaylhfnepdwiggditypegfreqmrqrfkggliycgn
ydagraqarlddntadavafgrpfianpdlperfrlgaalnepdpstfyggaevgytdyp
fldnghdrl

Sequence, based on observed residues (ATOM records): (download)

>d2r14a_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]}
npglftplqlgslslpnrvimapltrsrtpdsvpgrlqqiyygqrasagliiseatnisp
targyvytpgiwtdaqeagwkgvveavhakggrialqlwhvgrvshelvqpdgqqpvaps
alkaegaecfvefedgtaglhptstpraletdeipgivedyrqaaqrakragfdmvevha
anaclpnqflatgtnrrtdqyggsienrarfplevvdavaevfgpervgirltpflelfg
ltddepeamafylageldrrglaylhfnepdtypegfreqmrqrfkggliycgnydagra
qarlddntadavafgrpfianpdlperfrlgaalnepdpstfyggaevgytdypfldngh
drl

SCOPe Domain Coordinates for d2r14a_:

Click to download the PDB-style file with coordinates for d2r14a_.
(The format of our PDB-style files is described here.)

Timeline for d2r14a_: