SCOPe 2.07: Domain d2r0xa1: 2r0x A:11-157

Lineage for d2r0xa1 (2r0x A:11-157)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.0: automated matches [191365] (1 protein)
   not a true family

6. Protein automated matches [190439] (20 species)
   not a true protein

7. Species Haemophilus somnus [TaxId:205914] [188012] (1 PDB entry)

8. Domain d2r0xa1: 2r0x A:11-157 [167911]
   Other proteins in same PDB: d2r0xa2
   automated match to d1rz0a_
   complexed with act, edo, so4

Details for d2r0xa1

PDB Entry: 2r0x, 1.06 Å

PDB Description: crystal structure of a putative flavin reductase (ycdh, hs_1225) from haemophilus somnus 129pt at 1.06 a resolution

PDB Compounds: (A:) Possible flavin reductase

SCOPe Domain Sequences for d2r0xa1:

Sequence; same for both SEQRES and ATOM records:

>d2r0xa1 b.45.1.0 (A:11-157) automated matches {Haemophilus somnus [TaxId: 205914]}
maqlasavhivttsgetgqhgftasavcsvtdspptllvcinsnarayehfvknrvlmvn
tltaeqsslsnifasplsqeerfsnaswttlttgspmlqdalinfdceiteikhvgthdi
lickivdihqsnaknalvyrnrvyhsv

Timeline for d2r0xa1:

• d2r0xa1 first appeared in SCOPe 2.01, called d2r0xa_
  
• d2r0xa1 appears in SCOPe 2.06