Lineage for d2r0xa1 (2r0x A:11-157)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794132Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2794133Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2794356Family b.45.1.0: automated matches [191365] (1 protein)
    not a true family
  6. 2794357Protein automated matches [190439] (22 species)
    not a true protein
  7. 2794385Species Haemophilus somnus [TaxId:205914] [188012] (1 PDB entry)
  8. 2794386Domain d2r0xa1: 2r0x A:11-157 [167911]
    Other proteins in same PDB: d2r0xa2
    automated match to d1rz0a_
    complexed with act, edo, so4

Details for d2r0xa1

PDB Entry: 2r0x (more details), 1.06 Å

PDB Description: crystal structure of a putative flavin reductase (ycdh, hs_1225) from haemophilus somnus 129pt at 1.06 a resolution
PDB Compounds: (A:) Possible flavin reductase

SCOPe Domain Sequences for d2r0xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r0xa1 b.45.1.0 (A:11-157) automated matches {Haemophilus somnus [TaxId: 205914]}
maqlasavhivttsgetgqhgftasavcsvtdspptllvcinsnarayehfvknrvlmvn
tltaeqsslsnifasplsqeerfsnaswttlttgspmlqdalinfdceiteikhvgthdi
lickivdihqsnaknalvyrnrvyhsv

SCOPe Domain Coordinates for d2r0xa1:

Click to download the PDB-style file with coordinates for d2r0xa1.
(The format of our PDB-style files is described here.)

Timeline for d2r0xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r0xa2