![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.0: automated matches [191365] (1 protein) not a true family |
![]() | Protein automated matches [190439] (22 species) not a true protein |
![]() | Species Haemophilus somnus [TaxId:205914] [188012] (1 PDB entry) |
![]() | Domain d2r0xa1: 2r0x A:11-157 [167911] Other proteins in same PDB: d2r0xa2 automated match to d1rz0a_ complexed with act, edo, so4 |
PDB Entry: 2r0x (more details), 1.06 Å
SCOPe Domain Sequences for d2r0xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r0xa1 b.45.1.0 (A:11-157) automated matches {Haemophilus somnus [TaxId: 205914]} maqlasavhivttsgetgqhgftasavcsvtdspptllvcinsnarayehfvknrvlmvn tltaeqsslsnifasplsqeerfsnaswttlttgspmlqdalinfdceiteikhvgthdi lickivdihqsnaknalvyrnrvyhsv
Timeline for d2r0xa1: