SCOPe 2.08: Domain d2r0rb1: 2r0r B:3-79

Lineage for d2r0rb1 (2r0r B:3-79)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.64: Saposin-like [47861] (2 superfamilies)
   5 helices; folded leaf, closed

4. Superfamily a.64.1: Saposin [47862] (5 families)
   Lipid-binding can promote conformational changes and oligomerisation in some members

5. Family a.64.1.1: NKL-like [47863] (4 proteins)

6. Protein Saposin C [89077] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89078] (11 PDB entries)

8. Domain d2r0rb1: 2r0r B:3-79 [167910]
   Other proteins in same PDB: d2r0rb2
   automated match to d2gtga1
   complexed with so4

Details for d2r0rb1

PDB Entry: 2r0r, 2.5 Å

PDB Description: crystal structure of human saposin d variant sapd k9e

PDB Compounds: (B:) Proactivator polypeptide

SCOPe Domain Sequences for d2r0rb1:

Sequence; same for both SEQRES and ATOM records:

>d2r0rb1 a.64.1.1 (B:3-79) Saposin C {Human (Homo sapiens) [TaxId: 9606]}
gfcevceklvgyldrnleknstkqeilaalekgcsflpdpyqkqcdqfvaeyepvlieil
vevmdpsfvclkigacp

Timeline for d2r0rb1:

• d2r0rb1 first appeared in SCOPe 2.01, called d2r0rb_
  
• d2r0rb1 appears in SCOPe 2.07