Lineage for d2qzxb_ (2qzx B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1320913Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1320914Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1322142Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 1322829Protein automated matches [190156] (4 species)
    not a true protein
  7. 1322903Species Yeast (Candida albicans) [TaxId:5476] [188488] (4 PDB entries)
  8. 1322909Domain d2qzxb_: 2qzx B: [167898]
    automated match to d1eaga_

Details for d2qzxb_

PDB Entry: 2qzx (more details), 2.5 Å

PDB Description: secreted aspartic proteinase (sap) 5 from candida albicans
PDB Compounds: (B:) Candidapepsin-5

SCOPe Domain Sequences for d2qzxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qzxb_ b.50.1.2 (B:) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
gpvavtlhneaitytaditvgsdnqklnvivdtgssdlwipdsnvicipkwrgdkgdfck
sagsyspassrtsqnlntrfdikygdgsyakgklykdtvgiggvsvrdqlfanvwstsar
kgilgigfqsgeatefdydnlpislrnqgiigkaayslylnsaeastgqiifggidkaky
sgslvdlpitsekkltvglrsvnvrgrnvdantnvlldsgttisyftrsivrnilyaiga
qmkfdsagnkvyvadcktsgtidfqfgnnlkisvpvseflfqtyytsgkpfpkcevrire
sednilgdnflrsayvvynlddkkismapvkytsesdivain

SCOPe Domain Coordinates for d2qzxb_:

Click to download the PDB-style file with coordinates for d2qzxb_.
(The format of our PDB-style files is described here.)

Timeline for d2qzxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2qzxa_