Lineage for d2qzwb_ (2qzw B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2392462Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2393721Protein automated matches [190156] (5 species)
    not a true protein
  7. 2393798Species Yeast (Candida albicans) [TaxId:5476] [188488] (4 PDB entries)
  8. 2393801Domain d2qzwb_: 2qzw B: [167896]
    automated match to d1eaga_

Details for d2qzwb_

PDB Entry: 2qzw (more details), 2.05 Å

PDB Description: secreted aspartic proteinase (sap) 1 from candida albicans
PDB Compounds: (B:) Candidapepsin-1

SCOPe Domain Sequences for d2qzwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qzwb_ b.50.1.2 (B:) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
qaipvtlnnehvsyaaditigsnkqkfnvivdtgssdlwvpdasvtcdkprpgqsadfck
gkgiytpkssttsqnlgtpfyigygdgsssqgtlykdtvgfggasitkqvfaditktsip
qgilgigyktneaagdydnvpvtlknqgviaknayslylnspnaatgqiifggvdkakys
gsliavpvtsdrelritlnslkavgkningnidvlldsgttitylqqdvaqdiidafqae
lksdgqghtfyvtdcqtsgtvdfnfdnnakisvpaseftaplsyangqpypkcqlllgis
danilgdnflrsaylvydldddkislaqvkytsasniaalt

SCOPe Domain Coordinates for d2qzwb_:

Click to download the PDB-style file with coordinates for d2qzwb_.
(The format of our PDB-style files is described here.)

Timeline for d2qzwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2qzwa_