![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
![]() | Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
![]() | Protein automated matches [190156] (4 species) not a true protein |
![]() | Species Yeast (Candida albicans) [TaxId:5476] [188488] (4 PDB entries) |
![]() | Domain d2qzwa_: 2qzw A: [167895] automated match to d1eaga_ |
PDB Entry: 2qzw (more details), 2.05 Å
SCOPe Domain Sequences for d2qzwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qzwa_ b.50.1.2 (A:) automated matches {Yeast (Candida albicans) [TaxId: 5476]} qaipvtlnnehvsyaaditigsnkqkfnvivdtgssdlwvpdasvtcdkprpgqsadfck gkgiytpkssttsqnlgtpfyigygdgsssqgtlykdtvgfggasitkqvfaditktsip qgilgigyktneaagdydnvpvtlknqgviaknayslylnspnaatgqiifggvdkakys gsliavpvtsdrelritlnslkavgkningnidvlldsgttitylqqdvaqdiidafqae lksdgqghtfyvtdcqtsgtvdfnfdnnakisvpaseftaplsyangqpypkcqlllgis danilgdnflrsaylvydldddkislaqvkytsasniaalt
Timeline for d2qzwa_: