SCOPe 2.03: Domain d2qyha_: 2qyh A:

Lineage for d2qyha_ (2qyh A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (43 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:1462] [188567] (1 PDB entry)

8. Domain d2qyha_: 2qyh A: [167880]
   automated match to d1ymqa1
   complexed with gol

Details for d2qyha_

PDB Entry: 2qyh, 2.6 Å

PDB Description: Crystal structure of the hypothetical protein (gk1056) from geobacillus kaustophilus HTA426

PDB Compounds: (A:) Hypothetical conserved protein, GK1056

SCOPe Domain Sequences for d2qyha_:

Sequence; same for both SEQRES and ATOM records:

>d2qyha_ c.108.1.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
grkivffdidgtlldeqkqlplstieavrrlkqsgvyvaiatgrapfmfehvrkqlgids
fvsfngqyvvfegnvlykqplrrekvralteeahknghplvfmdaekmrasigdhphihv
smaslkfahppvdplyyenkdiyqallfcraeeeepyvrnypefrfvrwhdvstdvlpag
gskaegirmmieklgidkkdvyafgdglndiemlsfvgtgvamgnaheevkrvadfvtkp
vdkegiwyglkqlqli

Timeline for d2qyha_:

• d2qyha_ first appeared in SCOPe 2.01
  
• d2qyha_ appears in SCOPe 2.02
  
• d2qyha_ appears in SCOPe 2.04
  
• d2qyha_ appears in the current release, SCOPe 2.08