Lineage for d1riba_ (1rib A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2316569Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2316722Protein Ribonucleotide reductase R2 [47257] (10 species)
  7. 2316756Species Escherichia coli [TaxId:562] [47258] (24 PDB entries)
  8. 2316785Domain d1riba_: 1rib A: [16788]
    complexed with feo

Details for d1riba_

PDB Entry: 1rib (more details), 2.2 Å

PDB Description: structure and function of the escherichia coli ribonucleotide reductase protein r2
PDB Compounds: (A:) ribonucleotide reductase r1 protein

SCOPe Domain Sequences for d1riba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1riba_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
ayttfsatkndqlkepmffgqpvqvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfntrsnpipwintwlv

SCOPe Domain Coordinates for d1riba_:

Click to download the PDB-style file with coordinates for d1riba_.
(The format of our PDB-style files is described here.)

Timeline for d1riba_: