SCOPe 2.08: Domain d2qyfc_: 2qyf C:

Lineage for d2qyfc_ (2qyf C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.135: The spindle assembly checkpoint protein mad2 [56018] (1 superfamily)
   core: alpha(2)-beta(2)-alpha-beta; mixed sheet: order 213

4. Superfamily d.135.1: The spindle assembly checkpoint protein mad2 [56019] (2 families)
   N- and C-termini undergo large conformational rearrangement upon ligand binding
   automatically mapped to Pfam PF02301

5. Family d.135.1.1: The spindle assembly checkpoint protein mad2 [56020] (2 proteins)

6. Protein The spindle assembly checkpoint protein mad2 [56021] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56022] (5 PDB entries)

8. Domain d2qyfc_: 2qyf C: [167879]
   automated match to d1s2ha_

Details for d2qyfc_

PDB Entry: 2qyf, 2.3 Å

PDB Description: crystal structure of the mad2/p31(comet)/mad2-binding peptide ternary complex

PDB Compounds: (C:) mitotic spindle assembly checkpoint protein mad2a

SCOPe Domain Sequences for d2qyfc_:

Sequence, based on SEQRES records:

>d2qyfc_ d.135.1.1 (C:) The spindle assembly checkpoint protein mad2 {Human (Homo sapiens) [TaxId: 9606]}
targsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdlelikylnnvveq
lkdwlykcsvqklvvvisniesgevlerwqfdiecdktakddsapreksqkaiqdeirsv
irqitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnseevrlrsftttih
kvnsmvaykipvnd

Sequence, based on observed residues (ATOM records):

>d2qyfc_ d.135.1.1 (C:) The spindle assembly checkpoint protein mad2 {Human (Homo sapiens) [TaxId: 9606]}
targsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdlelikylnnvveq
lkdwlykcsvqklvvvisniesgevlerwqfdiecdksqkaiqdeirsvirqitatvtfl
pllevscsfdlliytdkdlvvpekweesgpqfitnseevrlrsftttihkvnsmvaykip
vnd

Timeline for d2qyfc_:

• d2qyfc_ first appeared in SCOPe 2.01
  
• d2qyfc_ appears in SCOPe 2.07