SCOPe 2.08: Domain d2qyfa_: 2qyf A:

Lineage for d2qyfa_ (2qyf A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.135: The spindle assembly checkpoint protein mad2 [56018] (1 superfamily)
   core: alpha(2)-beta(2)-alpha-beta; mixed sheet: order 213

4. Superfamily d.135.1: The spindle assembly checkpoint protein mad2 [56019] (2 families)
   N- and C-termini undergo large conformational rearrangement upon ligand binding
   automatically mapped to Pfam PF02301

5. Family d.135.1.1: The spindle assembly checkpoint protein mad2 [56020] (2 proteins)

6. Protein The spindle assembly checkpoint protein mad2 [56021] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56022] (5 PDB entries)

8. Domain d2qyfa_: 2qyf A: [167878]
   automated match to d1s2ha_

Details for d2qyfa_

PDB Entry: 2qyf, 2.3 Å

PDB Description: crystal structure of the mad2/p31(comet)/mad2-binding peptide ternary complex

PDB Compounds: (A:) mitotic spindle assembly checkpoint protein mad2a

SCOPe Domain Sequences for d2qyfa_:

Sequence; same for both SEQRES and ATOM records:

>d2qyfa_ d.135.1.1 (A:) The spindle assembly checkpoint protein mad2 {Human (Homo sapiens) [TaxId: 9606]}
qgitargsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdlelikylnnv
veqlkdwlykcsvqklvvvisniesgevlerwqfdiecdktakddsapreksqkaiqdei
rsvirqitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnseevrlrsftt
tihkvnsmvaykipvnd

Timeline for d2qyfa_:

• d2qyfa_ first appeared in SCOPe 2.01
  
• d2qyfa_ appears in SCOPe 2.07