Class b: All beta proteins [48724] (180 folds) |
Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.80.1: Pectin lyase-like [51126] (12 families) superhelix turns are made of 3 strands each |
Family b.80.1.0: automated matches [191490] (1 protein) not a true family |
Protein automated matches [190791] (5 species) not a true protein |
Species Xanthomonas campestris pv. campestris [TaxId:340] [188361] (2 PDB entries) |
Domain d2qxza_: 2qxz A: [167876] automated match to d1aira_ complexed with po4 |
PDB Entry: 2qxz (more details), 2.12 Å
SCOPe Domain Sequences for d2qxza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qxza_ b.80.1.0 (A:) automated matches {Xanthomonas campestris pv. campestris [TaxId: 340]} gpvgygaattgggnkvpvnvatfeamqsaidsysgsgglvlnytgkfdfgtikdvcaqwk lpaktvqiknksdvtikgangsaanfgirvvgnahnviiqnmtigllqggedadsisleg nssgepskiwvdhntvfasltkcsgagdasfdggidmkkgvhhvtvsynyvynyqkvaln gysdsdtknsaarttyhhnrfenvesrvplqrfglshiynnyfnnvttsginvrmggiak iesnyfeniknpvtsrdsseigywdlinnyvgsgitwgtpdgskpyanatnwistkvfpe slgyiytvtpaaqvkakviatagagknlae
Timeline for d2qxza_: