Lineage for d2qxza_ (2qxz A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813492Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813493Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2813674Family b.80.1.0: automated matches [191490] (1 protein)
    not a true family
  6. 2813675Protein automated matches [190791] (5 species)
    not a true protein
  7. 2813693Species Xanthomonas campestris pv. campestris [TaxId:340] [188361] (2 PDB entries)
  8. 2813694Domain d2qxza_: 2qxz A: [167876]
    automated match to d1aira_
    complexed with po4

Details for d2qxza_

PDB Entry: 2qxz (more details), 2.12 Å

PDB Description: pectate lyase r236f from xanthomonas campestris
PDB Compounds: (A:) Pectate lyase II

SCOPe Domain Sequences for d2qxza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qxza_ b.80.1.0 (A:) automated matches {Xanthomonas campestris pv. campestris [TaxId: 340]}
gpvgygaattgggnkvpvnvatfeamqsaidsysgsgglvlnytgkfdfgtikdvcaqwk
lpaktvqiknksdvtikgangsaanfgirvvgnahnviiqnmtigllqggedadsisleg
nssgepskiwvdhntvfasltkcsgagdasfdggidmkkgvhhvtvsynyvynyqkvaln
gysdsdtknsaarttyhhnrfenvesrvplqrfglshiynnyfnnvttsginvrmggiak
iesnyfeniknpvtsrdsseigywdlinnyvgsgitwgtpdgskpyanatnwistkvfpe
slgyiytvtpaaqvkakviatagagknlae

SCOPe Domain Coordinates for d2qxza_:

Click to download the PDB-style file with coordinates for d2qxza_.
(The format of our PDB-style files is described here.)

Timeline for d2qxza_: