SCOPe 2.07: Domain d2qxxb_: 2qxx B:

Lineage for d2qxxb_ (2qxx B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein Deoxycytidine triphosphate deaminase (dCTP deaminase) [117335] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:83332] [188349] (3 PDB entries)

8. Domain d2qxxb_: 2qxx B: [167875]
   automated match to d1xs1a_
   complexed with 1pe, mg, ttp

Details for d2qxxb_

PDB Entry: 2qxx, 2 Å

PDB Description: Bifunctional dCTP deaminase: dUTPase from Mycobacterium tuberculosis in complex with dTTP

PDB Compounds: (B:) deoxycytidine triphosphate deaminase

SCOPe Domain Sequences for d2qxxb_:

Sequence; same for both SEQRES and ATOM records:

>d2qxxb_ b.85.4.1 (B:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Mycobacterium tuberculosis [TaxId: 83332]}
mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel
tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstagfidp
gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps
rsyqnfirs

Timeline for d2qxxb_:

• d2qxxb_ first appeared in SCOPe 2.01
  
• d2qxxb_ appears in SCOPe 2.06
  
• d2qxxb_ appears in the current release, SCOPe 2.08