Class b: All beta proteins [48724] (174 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.1: dUTPase-like [51284] (5 proteins) |
Protein Deoxycytidine triphosphate deaminase (dCTP deaminase) [117335] (2 species) |
Species Mycobacterium tuberculosis [TaxId:83332] [188349] (1 PDB entry) |
Domain d2qxxa_: 2qxx A: [167874] automated match to d1xs1a_ complexed with 1pe, mg, ttp |
PDB Entry: 2qxx (more details), 2 Å
SCOPe Domain Sequences for d2qxxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qxxa_ b.85.4.1 (A:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Mycobacterium tuberculosis [TaxId: 83332]} mllsdrdlraeissgrlgidpfddtlvqpssidvrldclfrvfnntrythidpakqqdel tslvqpvdgepfvlhpgefvlgstlelftlpdnlagrlegksslgrlgllthstagfidp gfsghitlelsnvanlpitlwpgmkigqlcmlrltspsehpygssragskyqgqrgptps rsyqnfirs
Timeline for d2qxxa_: