SCOP 1.73: Domain d1biqb_: 1biq B:

Lineage for d1biqb_ (1biq B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.25: Ferritin-like [47239] (4 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (5 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (8 species)

7. Species Escherichia coli [TaxId:562] [47258] (23 PDB entries)

8. Domain d1biqb_: 1biq B: [16787]
   complexed with ehp, fe, fe2, hg, oh; mutant

Details for d1biqb_

PDB Entry: 1biq, 2.05 Å

PDB Description: ribonucleoside-diphosphate reductase 1 beta chain mutant e238a

PDB Compounds: (B:) protein r2 of ribonucleotide reductase

SCOP Domain Sequences for d1biqb_:

Sequence; same for both SEQRES and ATOM records:

>d1biqb_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sfthiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardaal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlvs

Timeline for d1biqb_:

• d1biqb_ first appeared (with stable ids) in SCOP 1.55
  
• d1biqb_ appears in SCOP 1.71
  
• d1biqb_ appears in SCOP 1.75
  
• d1biqb_ appears in the current release, SCOPe 2.08