SCOPe 2.01: Domain d2qxha_: 2qxh A:

Lineage for d2qxha_ (2qxh A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187421] (15 PDB entries)

8. Domain d2qxha_: 2qxh A: [167867]
   automated match to d1npma_
   complexed with k7j

Details for d2qxha_

PDB Entry: 2qxh, 2 Å

PDB Description: Crystal Structure of Human Kallikrein 7 in Complex with Suc-Ala-Ala-Pro-Phe-chloromethylketone

PDB Compounds: (A:) Kallikrein-7

SCOPe Domain Sequences for d2qxha_:

Sequence; same for both SEQRES and ATOM records:

>d2qxha_ b.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iidgapcargshpwqvallsgnqlhcggvlvnerwvltaahckmneytvhlgsdtlgdrr
aqrikasksfrhpgystqthvndlmlvklnsqarlssmvkkvrlpsrceppgttctvsgw
gtttspdvtfpsdlmcvdvklispqdctkvykdllensmlcagipdskknacngdsggpl
vcrgtlqglvswgtfpcgqpndpgvytqvckftkwindtmkkhr

Timeline for d2qxha_:

• d2qxha_ is new in SCOPe 2.01-stable
  
• d2qxha_ appears in SCOPe 2.02
  
• d2qxha_ appears in the current release, SCOPe 2.08