Lineage for d1biqa_ (1biq A:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.25: Ferritin-like [47239] (1 superfamily) Superfamily a.25.1: Ferritin-like [47240] (2 families) 
Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins) 
Protein Ribonucleotide reductase R2 [47257] (5 species) Species Escherichia coli [TaxId:562] [47258] (10 PDB entries) 
Domain d1biqa_: 1biq A: [16786]
Details for d1biqa_
PDB Entry: 1biq (more details), 2.05 Å
PDB Description: ribonucleoside-diphosphate reductase 1 beta chain mutant e238a
SCOP Domain Sequences for d1biqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1biqa_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia coli}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sfthiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardaal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlv
SCOP Domain Coordinates for d1biqa_:
Click to download the PDB-style file with coordinates for d1biqa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1biqa_:
- d1biqa_ first appeared (with stable ids) in SCOP 1.55
- d1biqa_ appears in SCOP 1.59
- d1biqa_ appears in SCOP 1.63
- d1biqa_ appears in the current release, SCOPe 2.08
View in 3D
