SCOPe 2.08: Domain d2qx3b_: 2qx3 B:

Lineage for d2qx3b_ (2qx3 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.80.1: Pectin lyase-like [51126] (12 families)
   superhelix turns are made of 3 strands each

5. Family b.80.1.0: automated matches [191490] (1 protein)
   not a true family

6. Protein automated matches [190791] (5 species)
   not a true protein

7. Species Xanthomonas campestris pv. campestris [TaxId:340] [188361] (2 PDB entries)

8. Domain d2qx3b_: 2qx3 B: [167850]
   automated match to d1aira_
   complexed with po4

Details for d2qx3b_

PDB Entry: 2qx3, 2 Å

PDB Description: structure of pectate lyase ii from xanthomonas campestris pv. campestris str. atcc 33913

PDB Compounds: (B:) Pectate lyase II

SCOPe Domain Sequences for d2qx3b_:

Sequence; same for both SEQRES and ATOM records:

>d2qx3b_ b.80.1.0 (B:) automated matches {Xanthomonas campestris pv. campestris [TaxId: 340]}
gpvgygaattgggnkvpvnvatfeamqsaidsysgsgglvlnytgkfdfgtikdvcaqwk
lpaktvqiknksdvtikgangsaanfgirvvgnahnviiqnmtigllqggedadsisleg
nssgepskiwvdhntvfasltkcsgagdasfdggidmkkgvhhvtvsynyvynyqkvaln
gysdsdtknsaarttyhhnrfenvesrvplqrrglshiynnyfnnvttsginvrmggiak
iesnyfeniknpvtsrdsseigywdlinnyvgsgitwgtpdgskpyanatnwistkvfpe
slgyiytvtpaaqvkakviatagagknlae

Timeline for d2qx3b_:

• d2qx3b_ first appeared in SCOPe 2.01
  
• d2qx3b_ appears in SCOPe 2.07