Lineage for d1xikb_ (1xik B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312408Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2312409Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314100Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2314253Protein Ribonucleotide reductase R2 [47257] (10 species)
  7. 2314287Species Escherichia coli [TaxId:562] [47258] (24 PDB entries)
  8. 2314299Domain d1xikb_: 1xik B: [16785]
    complexed with fe2, hg

Details for d1xikb_

PDB Entry: 1xik (more details), 1.7 Å

PDB Description: ribonucleoside-diphosphate reductase 1 beta chain
PDB Compounds: (B:) protein r2 of ribonucleotide reductase

SCOPe Domain Sequences for d1xikb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xikb_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlvs

SCOPe Domain Coordinates for d1xikb_:

Click to download the PDB-style file with coordinates for d1xikb_.
(The format of our PDB-style files is described here.)

Timeline for d1xikb_: