SCOPe 2.08: Domain d2qx0b_: 2qx0 B:

Lineage for d2qx0b_ (2qx0 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family)
   common fold is elaborated with additional secondary structures
   automatically mapped to Pfam PF01288

5. Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein)

6. Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (4 species)

7. Species Yersinia pestis [TaxId:632] [188233] (1 PDB entry)

8. Domain d2qx0b_: 2qx0 B: [167848]
   automated match to d1dy3a_
   complexed with apc, mg, ph2

Details for d2qx0b_

PDB Entry: 2qx0, 1.8 Å

PDB Description: Crystal Structure of Yersinia pestis HPPK (Ternary Complex)

PDB Compounds: (B:) 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase

SCOPe Domain Sequences for d2qx0b_:

Sequence; same for both SEQRES and ATOM records:

>d2qx0b_ d.58.30.1 (B:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Yersinia pestis [TaxId: 632]}
mirvyialgsnlamplqqvsaarealahlprsrlvacsplyrtkplgpqdqpdflnavva
ldtslppeqlldhtqaiernqgrvrkeqrwgprtldldimlygdqviktdrltiphyglk
arefmlypladiapdlifpdgeslseclkrvdknglvlw

Timeline for d2qx0b_:

• d2qx0b_ first appeared in SCOPe 2.01
  
• d2qx0b_ appears in SCOPe 2.07