SCOPe 2.05: Domain d1xika_: 1xik A:

Lineage for d1xika_ (1xik A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (9 species)

7. Species Escherichia coli [TaxId:562] [47258] (24 PDB entries)

8. Domain d1xika_: 1xik A: [16784]
   complexed with fe2, hg

Details for d1xika_

PDB Entry: 1xik, 1.7 Å

PDB Description: ribonucleoside-diphosphate reductase 1 beta chain

PDB Compounds: (A:) protein r2 of ribonucleotide reductase

SCOPe Domain Sequences for d1xika_:

Sequence; same for both SEQRES and ATOM records:

>d1xika_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlv

Timeline for d1xika_:

• d1xika_ first appeared (with stable ids) in SCOP 1.55
  
• d1xika_ appears in SCOPe 2.04
  
• d1xika_ appears in SCOPe 2.06
  
• d1xika_ appears in the current release, SCOPe 2.08