Lineage for d2qvjb_ (2qvj B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016186Fold a.260: Rhabdovirus nucleoprotein-like [140808] (1 superfamily)
    multihelical, consist of two helical domains; each domain contains a buried helix
  4. 2016187Superfamily a.260.1: Rhabdovirus nucleoprotein-like [140809] (1 family) (S)
    automatically mapped to Pfam PF00945
  5. 2016188Family a.260.1.1: Rhabdovirus nucleocapsid protein [140810] (2 protein domains)
    Pfam PF00945; RNA-binding homooligomeric protein
  6. 2016189Protein Nucleoprotein [140811] (2 species)
  7. 2016213Species Vesicular stomatitis indiana virus [TaxId:11277] [140813] (4 PDB entries)
    Uniprot P03521 2-422
  8. 2016215Domain d2qvjb_: 2qvj B: [167835]
    automated match to d2gica1
    mutant

Details for d2qvjb_

PDB Entry: 2qvj (more details), 2.8 Å

PDB Description: Crystal structure of a vesicular stomatitis virus nucleocapsid protein Ser290Trp mutant
PDB Compounds: (B:) nucleocapsid protein

SCOPe Domain Sequences for d2qvjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qvjb_ a.260.1.1 (B:) Nucleoprotein {Vesicular stomatitis indiana virus [TaxId: 11277]}
svtvkriidntvivpklpanedpveypadyfrkskeiplyinttkslsdlrgyvyqglks
gnvsiihvnsylygalkdirgkldkdwssfginigkagdtigifdlvslkaldgvlpdgv
sdasrtsaddkwlplyllglyrvgrtqmpeyrkklmdgltnqckmineqfeplvpegrdi
fdvwgndsnytkivaavdmffhmfkkhecasfrygtivsrfkdcaalatfghlckitgms
tedvttwilnrevademvqmmlpgqeidkadsympylidfglsskspywsvknpafhfwg
qltalllrstrarnarqpddieytslttagllyayavgssadlaqqfcvgdnkytpddst
gglttnappqgrdvvewlgwfedqnrkptpdmmqyakravmslqglrektigkyaksefd
k

SCOPe Domain Coordinates for d2qvjb_:

Click to download the PDB-style file with coordinates for d2qvjb_.
(The format of our PDB-style files is described here.)

Timeline for d2qvjb_: