SCOP 1.73: Domain d1mhzb_: 1mhz B:

Lineage for d1mhzb_ (1mhz B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.25: Ferritin-like [47239] (4 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (5 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)

6. Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)

7. Species Methylosinus trichosporium [TaxId:426] [88794] (2 PDB entries)

8. Domain d1mhzb_: 1mhz B: [16783]
   Other proteins in same PDB: d1mhzd_, d1mhzg_
   complexed with fe

Details for d1mhzb_

PDB Entry: 1mhz, 2.7 Å

PDB Description: methane monooxygenase hydroxylase

PDB Compounds: (B:) methane monooxygenase hydroxylase

SCOP Domain Sequences for d1mhzb_:

Sequence; same for both SEQRES and ATOM records:

>d1mhzb_ a.25.1.2 (B:) Methane monooxygenase hydrolase beta subunit {Methylosinus trichosporium [TaxId: 426]}
krgltdperaaiiaaavpdhaldtqrkyhyfiqprwkplseyeqlscyaqpnpdwiaggl
dwgdwtqkfhggrpswgnestelrttdwyrhrdparrwhhpyvkdkseearytqrflaay
ssegsirtidpywrdeilnkyfgallyseyglfnahssvgrdclsdtirqtavfaaldkv
dnaqmiqmerlfiaklvpgfdastdvpkkiwttdpiysgaratvqeiwqgvqdwneilwa
ghavydatfgqfarreffqrlatvygdtltpfftaqsqtyfqttrgaiddlfvyclands
efgahnrtflnawtehylassvaalkdfvglyakvekvagatdsagvsealqrvfgdwki
dyadkigfrvdvdqkvdavlagy

Timeline for d1mhzb_:

• d1mhzb_ first appeared (with stable ids) in SCOP 1.55
  
• d1mhzb_ appears in SCOP 1.71
  
• d1mhzb_ appears in SCOP 1.75
  
• d1mhzb_ appears in the current release, SCOPe 2.08