Lineage for d1mhzb_ (1mhz B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 441060Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 441061Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 441421Family a.25.1.2: Ribonucleotide reductase-like [47253] (7 proteins)
  6. 441484Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 441516Species Methylosinus trichosporium [TaxId:426] [88794] (2 PDB entries)
  8. 441518Domain d1mhzb_: 1mhz B: [16783]
    Other proteins in same PDB: d1mhzd_, d1mhzg_

Details for d1mhzb_

PDB Entry: 1mhz (more details), 2.7 Å

PDB Description: methane monooxygenase hydroxylase

SCOP Domain Sequences for d1mhzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhzb_ a.25.1.2 (B:) Methane monooxygenase hydrolase beta subunit {Methylosinus trichosporium}
krgltdperaaiiaaavpdhaldtqrkyhyfiqprwkplseyeqlscyaqpnpdwiaggl
dwgdwtqkfhggrpswgnestelrttdwyrhrdparrwhhpyvkdkseearytqrflaay
ssegsirtidpywrdeilnkyfgallyseyglfnahssvgrdclsdtirqtavfaaldkv
dnaqmiqmerlfiaklvpgfdastdvpkkiwttdpiysgaratvqeiwqgvqdwneilwa
ghavydatfgqfarreffqrlatvygdtltpfftaqsqtyfqttrgaiddlfvyclands
efgahnrtflnawtehylassvaalkdfvglyakvekvagatdsagvsealqrvfgdwki
dyadkigfrvdvdqkvdavlagy

SCOP Domain Coordinates for d1mhzb_:

Click to download the PDB-style file with coordinates for d1mhzb_.
(The format of our PDB-style files is described here.)

Timeline for d1mhzb_: