| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) 6-standed beta-sheet followed with 2 helices; meander |
Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) ![]() |
| Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins) |
| Protein automated matches [190495] (3 species) not a true protein |
| Species Pseudomonas phage [TaxId:12023] [188304] (2 PDB entries) |
| Domain d2quxn_: 2qux N: [167827] Other proteins in same PDB: d2quxa2, d2quxg2, d2quxj2, d2quxk2 automated match to d1dwna_ protein/RNA complex; complexed with gol |
PDB Entry: 2qux (more details), 2.44 Å
SCOPe Domain Sequences for d2quxn_:
Sequence, based on SEQRES records: (download)
>d2quxn_ d.85.1.1 (N:) automated matches {Pseudomonas phage [TaxId: 12023]}
sktivlsvgeatrtlteiqstadrqifeekvgplvgrlrltaslrqngaktayrvnlkld
qadvvdsglpkvrytqvwshdvtivansteasrkslydltkslvatsqvedlvvnlvplg
r
>d2quxn_ d.85.1.1 (N:) automated matches {Pseudomonas phage [TaxId: 12023]}
sktivlsvgeatrtlteiqstrqifeekvgplvgrlrltaslrqngaktayrvnlkldqa
dvvdsglpkvrytqvwshdvtivansteasrkslydltkslvatsqvedlvvnlvplgr
Timeline for d2quxn_: