Lineage for d2quxn_ (2qux N:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962441Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 2962442Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 2962443Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 2962611Protein automated matches [190495] (3 species)
    not a true protein
  7. 2962626Species Pseudomonas phage [TaxId:12023] [188304] (2 PDB entries)
  8. 2962638Domain d2quxn_: 2qux N: [167827]
    Other proteins in same PDB: d2quxa2, d2quxg2, d2quxj2, d2quxk2
    automated match to d1dwna_
    protein/RNA complex; complexed with gol

Details for d2quxn_

PDB Entry: 2qux (more details), 2.44 Å

PDB Description: pp7 coat protein dimer in complex with rna hairpin
PDB Compounds: (N:) coat protein

SCOPe Domain Sequences for d2quxn_:

Sequence, based on SEQRES records: (download)

>d2quxn_ d.85.1.1 (N:) automated matches {Pseudomonas phage [TaxId: 12023]}
sktivlsvgeatrtlteiqstadrqifeekvgplvgrlrltaslrqngaktayrvnlkld
qadvvdsglpkvrytqvwshdvtivansteasrkslydltkslvatsqvedlvvnlvplg
r

Sequence, based on observed residues (ATOM records): (download)

>d2quxn_ d.85.1.1 (N:) automated matches {Pseudomonas phage [TaxId: 12023]}
sktivlsvgeatrtlteiqstrqifeekvgplvgrlrltaslrqngaktayrvnlkldqa
dvvdsglpkvrytqvwshdvtivansteasrkslydltkslvatsqvedlvvnlvplgr

SCOPe Domain Coordinates for d2quxn_:

Click to download the PDB-style file with coordinates for d2quxn_.
(The format of our PDB-style files is described here.)

Timeline for d2quxn_: