Lineage for d2quxh_ (2qux H:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1916511Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 1916512Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 1916513Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 1916655Protein automated matches [190495] (3 species)
    not a true protein
  7. 1916670Species Pseudomonas phage [TaxId:12023] [188304] (2 PDB entries)
  8. 1916678Domain d2quxh_: 2qux H: [167823]
    automated match to d1dwna_
    protein/RNA complex; complexed with gol

Details for d2quxh_

PDB Entry: 2qux (more details), 2.44 Å

PDB Description: pp7 coat protein dimer in complex with rna hairpin
PDB Compounds: (H:) coat protein

SCOPe Domain Sequences for d2quxh_:

Sequence, based on SEQRES records: (download)

>d2quxh_ d.85.1.1 (H:) automated matches {Pseudomonas phage [TaxId: 12023]}
sktivlsvgeatrtlteiqstadrqifeekvgplvgrlrltaslrqngaktayrvnlkld
qadvvdsglpkvrytqvwshdvtivansteasrkslydltkslvatsqvedlvvnlvplg
r

Sequence, based on observed residues (ATOM records): (download)

>d2quxh_ d.85.1.1 (H:) automated matches {Pseudomonas phage [TaxId: 12023]}
sktivlsvgeatrtlteiqstrqifeekvgplvgrlrltaslrqngaktayrvnlkldqa
dvvdsglpkvrytqvwshdvtivansteasrkslydltkslvatsqvedlvvnlvplgr

SCOPe Domain Coordinates for d2quxh_:

Click to download the PDB-style file with coordinates for d2quxh_.
(The format of our PDB-style files is described here.)

Timeline for d2quxh_: