Lineage for d2quxd_ (2qux D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1422709Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 1422710Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 1422711Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 1422850Protein automated matches [190495] (3 species)
    not a true protein
  7. 1422859Species Pseudomonas phage [TaxId:12023] [188304] (2 PDB entries)
  8. 1422864Domain d2quxd_: 2qux D: [167820]
    automated match to d1dwna_
    protein/RNA complex; complexed with gol

Details for d2quxd_

PDB Entry: 2qux (more details), 2.44 Å

PDB Description: pp7 coat protein dimer in complex with rna hairpin
PDB Compounds: (D:) coat protein

SCOPe Domain Sequences for d2quxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2quxd_ d.85.1.1 (D:) automated matches {Pseudomonas phage [TaxId: 12023]}
msktivlsvgeatrtlteiqstadrqifeekvgplvgrlrltaslrqngaktayrvnlkl
dqadvvdsglpkvrytqvwshdvtivansteasrkslydltkslvatsqvedlvvnlvpl
gr

SCOPe Domain Coordinates for d2quxd_:

Click to download the PDB-style file with coordinates for d2quxd_.
(The format of our PDB-style files is described here.)

Timeline for d2quxd_: