Lineage for d1mhzd_ (1mhz D:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2448Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 2449Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 2557Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins)
  6. 2566Protein Methane monooxygenase hydrolase, beta and alpha subunits [47254] (2 species)
  7. 2608Species Methylosinus trichosporium [TaxId:426] [47256] (2 PDB entries)
  8. 2612Domain d1mhzd_: 1mhz D: [16782]
    Other proteins in same PDB: d1mhzg_

Details for d1mhzd_

PDB Entry: 1mhz (more details), 2.7 Å

PDB Description: methane monooxygenase hydroxylase
PDB Compounds: (D:)

SCOP Domain Sequences for d1mhzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhzd_ a.25.1.2 (D:) Methane monooxygenase hydrolase, beta and alpha subunits {Methylosinus trichosporium}
nrapvgvepqevhkwlqsfnwdfkenrtkyptkyhmanetkeqfkviakeyarmeaakde
rqfgtlldgltrlgagnkvhprwgetmkvisnflevgeynaiaasamlwdsataaeqkng
ylaqvldeirhthqcafinhyyskhyhdpaghndarrtraigplwkgmkrvfadgfisgd
avecsvnlqlvgeacftnplivavtewasangdeitptvflsvetdelrhmangyqtvvs
iandpasakflntdlnnafwtqqkyftpvlgylfeygskfkvepwvktwnrwvsedwggi
wigrlgkygvesprslrdakrdaywahhdlalaayamwplgfarlalpdeedqawfeany
pgwadhygkifnewkklgyedpksgfipyqwllanghdvyidrvsqvpfipslakgtgsl
rvhefngkkhsltddwgerqwlieperyechnvfeqyegrelseviaeghgvrsdgktli
aqphtrgdnlwtledikragcvfpdplakf

SCOP Domain Coordinates for d1mhzd_:

Click to download the PDB-style file with coordinates for d1mhzd_.
(The format of our PDB-style files is described here.)

Timeline for d1mhzd_: