SCOPe 2.02: Domain d2qudb_: 2qud B:

Lineage for d2qudb_ (2qud B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
   6-standed beta-sheet followed with 2 helices; meander

4. Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family)

5. Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)

6. Protein automated matches [190495] (3 species)
   not a true protein

7. Species Pseudomonas phage [TaxId:12023] [188304] (2 PDB entries)

8. Domain d2qudb_: 2qud B: [167811]
   automated match to d1dwna_
   protein/RNA complex; complexed with gol

Details for d2qudb_

PDB Entry: 2qud, 1.6 Å

PDB Description: pp7 coat protein dimer

PDB Compounds: (B:) coat protein

SCOPe Domain Sequences for d2qudb_:

Sequence, based on SEQRES records:

>d2qudb_ d.85.1.1 (B:) automated matches {Pseudomonas phage [TaxId: 12023]}
sktivlsvgeatrtlteiqstadrqifeekvgplvgrlrltaslrqngaktayrvnlkld
qadvvdsglpkvrytqvwshdvtivansteasrkslydltkslvatsqvedlvvnlvplg
r

Sequence, based on observed residues (ATOM records):

>d2qudb_ d.85.1.1 (B:) automated matches {Pseudomonas phage [TaxId: 12023]}
sktivlsvgeatrtlteiqstadrqifeekvgplvgrlrltaslrqngaktayrvnlkld
qadvvpkvrytqvwshdvtivansteasrkslydltkslvatsqvedlvvnlvplgr

Timeline for d2qudb_:

• d2qudb_ first appeared in SCOPe 2.01
  
• d2qudb_ appears in SCOPe 2.03
  
• d2qudb_ appears in the current release, SCOPe 2.08