SCOPe 2.08: Domain d2quda1: 2qud A:0-127

Lineage for d2quda1 (2qud A:0-127)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
   6-standed beta-sheet followed with 2 helices; meander

4. Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family)

5. Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)

6. Protein automated matches [190495] (3 species)
   not a true protein

7. Species Pseudomonas phage [TaxId:12023] [188304] (2 PDB entries)

8. Domain d2quda1: 2qud A:0-127 [167810]
   Other proteins in same PDB: d2quda2
   automated match to d1dwna_
   protein/RNA complex; complexed with gol

Details for d2quda1

PDB Entry: 2qud, 1.6 Å

PDB Description: pp7 coat protein dimer

PDB Compounds: (A:) coat protein

SCOPe Domain Sequences for d2quda1:

Sequence; same for both SEQRES and ATOM records:

>d2quda1 d.85.1.1 (A:0-127) automated matches {Pseudomonas phage [TaxId: 12023]}
msktivlsvgeatrtlteiqstadrqifeekvgplvgrlrltaslrqngaktayrvnlkl
dqadvvdsglpkvrytqvwshdvtivansteasrkslydltkslvatsqvedlvvnlvpl
gr

Timeline for d2quda1:

• d2quda1 first appeared in SCOPe 2.01, called d2quda_
  
• d2quda1 appears in SCOPe 2.07