Lineage for d1mhyb_ (1mhy B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 536008Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 536009Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 536385Family a.25.1.2: Ribonucleotide reductase-like [47253] (7 proteins)
  6. 536448Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 536480Species Methylosinus trichosporium [TaxId:426] [88794] (2 PDB entries)
  8. 536481Domain d1mhyb_: 1mhy B: [16781]
    Other proteins in same PDB: d1mhyd_, d1mhyg_
    complexed with fe

Details for d1mhyb_

PDB Entry: 1mhy (more details), 2 Å

PDB Description: methane monooxygenase hydroxylase
PDB Compounds: (B:)

SCOP Domain Sequences for d1mhyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhyb_ a.25.1.2 (B:) Methane monooxygenase hydrolase beta subunit {Methylosinus trichosporium}
krgltdperaaiiaaavpdhaldtqrkyhyfiqprwkplseyeqlscyaqpnpdwiaggl
dwgdwtqkfhggrpswgnestelrttdwyrhrdparrwhhpyvkdkseearytqrflaay
ssegsirtidpywrdeilnkyfgallyseyglfnahssvgrdclsdtirqtavfaaldkv
dnaqmiqmerlfiaklvpgfdastdvpkkiwttdpiysgaratvqeiwqgvqdwneilwa
ghavydatfgqfarreffqrlatvygdtltpfftaqsqtyfqttrgaiddlfvyclands
efgahnrtflnawtehylassvaalkdfvglyakvekvagatdsagvsealqrvfgdwki
dyadkigfrvdvdqkvdavlagy

SCOP Domain Coordinates for d1mhyb_:

Click to download the PDB-style file with coordinates for d1mhyb_.
(The format of our PDB-style files is described here.)

Timeline for d1mhyb_: