SCOPe 2.08: Domain d1mhyb_: 1mhy B:

Lineage for d1mhyb_ (1mhy B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)

7. Species Methylosinus trichosporium [TaxId:426] [88794] (2 PDB entries)

8. Domain d1mhyb_: 1mhy B: [16781]
   Other proteins in same PDB: d1mhyd_, d1mhyg_
   complexed with fe
   has additional insertions and/or extensions that are not grouped together

Details for d1mhyb_

PDB Entry: 1mhy, 2 Å

PDB Description: methane monooxygenase hydroxylase

PDB Compounds: (B:) methane monooxygenase hydroxylase

SCOPe Domain Sequences for d1mhyb_:

Sequence; same for both SEQRES and ATOM records:

>d1mhyb_ a.25.1.2 (B:) Methane monooxygenase hydrolase beta subunit {Methylosinus trichosporium [TaxId: 426]}
krgltdperaaiiaaavpdhaldtqrkyhyfiqprwkplseyeqlscyaqpnpdwiaggl
dwgdwtqkfhggrpswgnestelrttdwyrhrdparrwhhpyvkdkseearytqrflaay
ssegsirtidpywrdeilnkyfgallyseyglfnahssvgrdclsdtirqtavfaaldkv
dnaqmiqmerlfiaklvpgfdastdvpkkiwttdpiysgaratvqeiwqgvqdwneilwa
ghavydatfgqfarreffqrlatvygdtltpfftaqsqtyfqttrgaiddlfvyclands
efgahnrtflnawtehylassvaalkdfvglyakvekvagatdsagvsealqrvfgdwki
dyadkigfrvdvdqkvdavlagy

Timeline for d1mhyb_:

• d1mhyb_ first appeared (with stable ids) in SCOP 1.55
  
• d1mhyb_ appears in SCOPe 2.07