SCOPe 2.04: Domain d2qu0d_: 2qu0 D:

Lineage for d2qu0d_ (2qu0 D:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (38 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [188522] (1 PDB entry)

8. Domain d2qu0d_: 2qu0 D: [167805]
   automated match to d1fsxb_
   complexed with hem

Details for d2qu0d_

PDB Entry: 2qu0, 2.7 Å

PDB Description: crystal structure determination of sheep methemoglobin at 2.7 angstrom resolution

PDB Compounds: (D:) Hemoglobin subunit beta

SCOPe Domain Sequences for d2qu0d_:

Sequence; same for both SEQRES and ATOM records:

>d2qu0d_ a.1.1.2 (D:) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mltaeekaavtgfwgkvkvdevgaealgrllvvypwtqrffehfgdlsnadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaqlselhcdklhvdpenfrllgnvlvvvlarhhgne
ftpvlqadfqkvvagvanalahkyh

Timeline for d2qu0d_:

• d2qu0d_ first appeared in SCOPe 2.01
  
• d2qu0d_ appears in SCOPe 2.03
  
• d2qu0d_ appears in SCOPe 2.05
  
• d2qu0d_ appears in the current release, SCOPe 2.08