| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
| Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
| Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species) |
| Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188506] (4 PDB entries) |
| Domain d2qtrb_: 2qtr B: [167800] automated match to d1kama_ complexed with nxx, so4 |
PDB Entry: 2qtr (more details), 1.7 Å
SCOPe Domain Sequences for d2qtrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qtrb_ c.26.1.3 (B:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrnitsvesrlqml
elateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwynie
alldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvqvy
iernglyes
Timeline for d2qtrb_: