SCOPe 2.05: Domain d2qtnb_: 2qtn B:

Lineage for d2qtnb_ (2qtn B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)

6. Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species)

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188506] (4 PDB entries)

8. Domain d2qtnb_: 2qtn B: [167798]
   automated match to d1kama_
   complexed with gol, mg, ncn

Details for d2qtnb_

PDB Entry: 2qtn, 2.4 Å

PDB Description: crystal structure of nicotinate mononucleotide adenylyltransferase

PDB Compounds: (B:) Nicotinate (Nicotinamide) nucleotide adenylyltransferase

SCOPe Domain Sequences for d2qtnb_:

Sequence; same for both SEQRES and ATOM records:

>d2qtnb_ c.26.1.3 (B:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrditsvesrlqml
elateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwynie
alldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvqvy
iernglyes

Timeline for d2qtnb_:

• d2qtnb_ first appeared in SCOPe 2.01
  
• d2qtnb_ appears in SCOPe 2.04
  
• d2qtnb_ appears in SCOPe 2.06
  
• d2qtnb_ appears in the current release, SCOPe 2.08